Analytical Data
-
Gene name
KIAA1143
- Application
-
Alternative Names
KIAA1143; Uncharacterized protein KIAA1143
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96AT1
-
Expression Region
1-154aa
-
AA Sequence
MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVVVLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENE
-
Molecular Weight
43.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA1143 is a protein that has garnered attention in the field of molecular biology and cancer research due to its potential implications in cellular functions and disease mechanisms. Initially identified through genomic studies, the KIAA family of proteins is known for their diverse roles in cellular processes, including cell proliferation, differentiation, and apoptosis. Recent studies have suggested that KIAA1143 may be involved in the regulation of the cell cycle and DNA repair mechanisms, which are critical for maintaining genomic stability. Alterations in the expression levels or mutations of KIAA1143 have been implicated in various cancers, making it a candidate for further investigation in the context of tumor biology. Researchers are particularly interested in characterizing the recombinant form of KIAA1143, as understanding its structural and functional properties could reveal insights into its biological roles. Recombinant protein studies may help elucidate its interactions with other cellular molecules and pathways, as well as its potential as a therapeutic target. As the understanding of KIAA1143 advances, it may pave the way for novel approaches in cancer treatment and biomarker discovery, highlighting the significance of this protein in both basic research and clinical applications. Overall, the exploration of KIAA1143 through recombinant protein technology represents a promising avenue for unraveling its biological significance and therapeutic potential.
