Cat: PA1000-1732

Recombinant Human HK1/KLK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HK1/KLK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06870

  • Expression Region

    19-262aa

  • AA Sequence

    PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCIS DNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYS HDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSF PDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPL MCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENSVDHHHH HH

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HK1 (Hexokinase 1) and KLK1 (Kallikrein 1) are proteins that have garnered significant attention in biomedical research due to their roles in various physiological and pathological processes. HK1 is an essential enzyme in the glycolytic pathway, responsible for phosphorylating glucose, thus playing a crucial role in cellular energy metabolism. Its involvement in cancer metabolism has led to investigations into its potential as a therapeutic target, where altered expression levels may influence tumor growth and survival. On the other hand, KLK1, a member of the kallikrein-related peptidase family, is implicated in cardiovascular regulation and has been associated with inflammatory processes and tumor progression. Research has shown that KLK1 can enhance angiogenesis and promote cancer cell invasion, making it a potential biomarker for certain cancers. The recombination of HK1 and KLK1 proteins aims to explore their functional interactions in metabolic disorders and cancer biology, possibly yielding new therapeutic strategies or diagnostic tools. Recent advancements in recombinant protein technology facilitate the production of these proteins in vitro, allowing for thorough biochemical and biophysical characterization and the investigation of their roles in disease contexts. Understanding the mechanisms of HK1 and KLK1 at a molecular level could provide insights into their contributions to disease and pave the way for innovative treatments targeting these pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US