Analytical Data
-
Gene name
KLF6
- Application
-
Alternative Names
KLF6;BCD1;COPEB;CPBP;Krueppel-like factor 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99612
-
Expression Region
1-261aa
-
AA Sequence
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYV SASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE TNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPS SPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH RCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRH FRKHTGAKPF
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLF6 (Krüppel-like factor 6) is a transcription factor belonging to the KLF family, which plays a crucial role in various biological processes, including cell differentiation, proliferation, and apoptosis. The study of KLF6 has garnered significant attention due to its implications in cancer biology, particularly its tumor suppressor role in several malignancies. It is known that KLF6 undergoes alternative splicing, resulting in various isoforms that exhibit distinct regulatory functions. This complexity in its expression patterns has made it a focal point of research aimed at understanding its involvement in tumorigenesis and potential therapeutic applications. Moreover, the development of recombinant KLF6 proteins has enabled researchers to investigate the specific functions of different isoforms in cell signaling and gene regulation. By using these proteins in biochemical assays and cellular models, scientists aim to elucidate the mechanisms by which KLF6 influences cancer progression and responses to treatments. Furthermore, understanding the post-translational modifications and interactions of KLF6 proteins may provide insights into their functional diversity and regulatory networks in cancer cells. As research progresses, recombinant KLF6 proteins are anticipated to not only advance our comprehension of KLF6 biology but also lay the groundwork for novel strategies in cancer therapy, highlighting the importance of this transcription factor in potential clinical applications.
