Analytical Data
-
Gene name
KIAA0804
- Application
-
Alternative Names
VPS8; KIAA0804; Vacuolar protein sorting-associated protein 8 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N3P4
-
Expression Region
1-92aa
-
AA Sequence
MSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA0804, a gene identified through genome sequencing projects, has garnered attention in the field of molecular biology and genetics due to its potential role in various cellular processes and disease mechanisms. Initial studies suggested that KIAA0804 may be involved in the regulation of cell proliferation and differentiation, which are critical for normal development and tissue homeostasis. Moreover, its expression patterns have been associated with certain cancers, indicating that KIAA0804 could play a role in tumorigenesis or progression. The recombinant protein derived from KIAA0804 has been a focus of research, as it provides a valuable tool for investigating the protein's function, interactions, and potential as a therapeutic target. Utilizing techniques such as recombinant DNA technology, researchers have successfully produced the KIAA0804 protein, enabling in vitro assays to explore its biological activities and signaling pathways. Additionally, understanding the structural attributes of KIAA0804 through protein crystallization and characterization can shed light on its mechanism of action and interaction with other cellular components. The ongoing research into KIAA0804 and its recombinant protein represents a promising avenue for elucidating its role in health and disease, which may ultimately lead to innovative therapeutic strategies for conditions linked to aberrant KIAA0804 expression or function.
