Cat: PA2000-8649

Recombinant Human KIAA0804 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KIAA0804

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VPS8; KIAA0804; Vacuolar protein sorting-associated protein 8 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N3P4

  • Expression Region

    1-92aa

  • AA Sequence

    MSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRLALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED

  • Molecular Weight

    36.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KIAA0804, a gene identified through genome sequencing projects, has garnered attention in the field of molecular biology and genetics due to its potential role in various cellular processes and disease mechanisms. Initial studies suggested that KIAA0804 may be involved in the regulation of cell proliferation and differentiation, which are critical for normal development and tissue homeostasis. Moreover, its expression patterns have been associated with certain cancers, indicating that KIAA0804 could play a role in tumorigenesis or progression. The recombinant protein derived from KIAA0804 has been a focus of research, as it provides a valuable tool for investigating the protein's function, interactions, and potential as a therapeutic target. Utilizing techniques such as recombinant DNA technology, researchers have successfully produced the KIAA0804 protein, enabling in vitro assays to explore its biological activities and signaling pathways. Additionally, understanding the structural attributes of KIAA0804 through protein crystallization and characterization can shed light on its mechanism of action and interaction with other cellular components. The ongoing research into KIAA0804 and its recombinant protein represents a promising avenue for elucidating its role in health and disease, which may ultimately lead to innovative therapeutic strategies for conditions linked to aberrant KIAA0804 expression or function.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US