Cat: PA2000-4541

Recombinant Human algL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    algL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    algL;Alginate lyase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O52195

  • Expression Region

    24-374aa

  • AA Sequence

    AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARST LNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWA EDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRI ESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWA VEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGV DLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWL EPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKR D

  • Molecular Weight

    59 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AlgL, a key enzyme in the bacterial alginate degradation pathway, plays a significant role in the metabolism of alginate, a polysaccharide found in the cell walls of brown algae and produced by certain bacteria. The study of AlgL has gained importance due to its potential applications in biotechnology and environmental sustainability. Alginate is widely used in food, pharmaceuticals, and biomedicine, and its degradation can be harnessed for bioconversion processes. Understanding the structure and function of AlgL can lead to advancements in bioremediation technologies, enabling more efficient breakdown of alginate-rich waste. Moreover, the recombinant production of AlgL allows for detailed kinetic studies and structure-function analyses, enhancing our knowledge of polypeptide interactions and enzyme mechanisms. Research has also focused on the gene regulation of alginate degradation, which can provide insights into the adaptive strategies of bacteria in different nutrient environments. Thus, AlgL serves as a model enzyme for studying polysaccharide lyases and their potential exploitation in various industrial applications, making it a subject of growing interest in enzymology and biotechnology research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US