Analytical Data
-
Gene name
NR2F1
- Application
-
Alternative Names
NR2F1；TF2B；TFIIB；Transcription initiation factor IIB
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10589
-
Expression Region
1-423aa
-
AA Sequence
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NR2F1, or Nuclear Receptor Subfamily 2 Group F Member 1, is a crucial transcription factor that plays significant roles in various biological processes, including development, cellular differentiation, and metabolism. It is part of the nuclear receptor superfamily, which regulates gene expression in response to hormones and other signaling molecules. Recent studies have implicated NR2F1 in multiple diseases, including neurodevelopmental disorders, cancer, and metabolic syndromes, underscoring its potential as a therapeutic target. The recombinant NR2F1 protein is essential for elucidating its functional mechanisms and interactions at the molecular level. Researchers are increasingly utilizing recombinant DNA technology to produce NR2F1 in heterologous systems, facilitating the study of its structure-function relationships, ligand-binding properties, and downstream gene regulation. These studies aim to provide insights into the signaling pathways involving NR2F1 and how alterations in its activity may contribute to disease pathogenesis. Understanding NR2F1’s role through the analysis of its recombinant protein is vital for developing novel therapeutics and advancing our knowledge of its biological significance in health and disease.
