Analytical Data
-
Gene name
KCNMB3
- Application
-
Alternative Names
KCNMA1;KCNMA;SLO;Calcium-activated potassium channel subunit alpha-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPA1
-
Expression Region
82-207aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSKPFMLSIQREESTCTAIHTDIMDDWLD CAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTP KCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQ
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNMB3, also known as the beta subunit of the calcium-activated potassium channel (KCa) family, plays a crucial role in modulating the activity of KCa channels, particularly in smooth muscle and neuronal tissues. The understanding of KCNMB3 is significant due to its involvement in various physiological processes, including vasodilation, neurotransmission, and neuronal excitability. Abnormalities in KCNMB3 function have been linked to various pathological conditions, such as hypertension and neurodegenerative diseases. Recombinant KCNMB3 protein is often produced to study its structural properties, functional mechanisms, and interactions with other channel subunits and signaling molecules. Advances in protein expression systems and purification techniques have facilitated the generation of high-quality recombinant KCNMB3, allowing researchers to conduct detailed investigations into its biophysical characteristics and pharmacological profiles. Understanding the role of KCNMB3 is vital for developing potential therapeutic strategies targeting KCa channels, offering insights into the modulation of vascular tone and neuronal signaling, ultimately contributing to better management of cardiovascular and neurological disorders.
