Analytical Data
-
Gene name
KAAG1
- Application
-
Alternative Names
KAAG1;RU2AS;Kidney-associated antigen 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBP8
-
Expression Region
1-84aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDDDAAPRVEGVPVAVHKHALHDGLRQVAG PGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQ VKEK
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KAAG1, or Kynurenine Aminotransferase II, is an enzyme that plays a critical role in the kynurenine pathway, which is vital for tryptophan metabolism and the production of neuroactive metabolites. The study of KAAG1 has garnered significant attention due to its implications in various physiological and pathological processes, including neurodegenerative diseases, psychiatric disorders, and immune responses. Research has shown that dysregulation of the kynurenine pathway is linked to conditions such as depression and Alzheimer's disease, highlighting the importance of KAAG1 as a potential therapeutic target. Furthermore, the enzymatic activity of KAAG1 can influence the levels of neuroprotective and neurotoxic metabolites, thereby affecting neuronal health and function. Investigating the structural and functional properties of recombinant KAAG1 protein allows for a deeper understanding of its biological role and opens avenues for drug development aimed at modulating its activity. In recent studies, researchers have focused on the production of recombinant KAAG1 to explore its biochemical characteristics, assay methods, and potential inhibitors. This research not only contributes to the foundational knowledge of KAAG1 but also paves the way for its application in drug discovery and the development of novel therapeutic strategies for treating disorders associated with altered kynurenine metabolism.
