Analytical Data
-
Gene name
KCNIP3
- Application
-
Alternative Names
KCNIP3;CSEN;DREAM;KCHIP3;Calsenilin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2W7
-
Expression Region
1-256aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQPAKEVTKASDGSLLGDLGHTPLSKKEGI KWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLD QLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTY AHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVV TIEEFLEACQKDENIMSSMQLFENVI
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNIP3, also known as K+ channel interacting protein 3, is a critical member of the KCNIP family involved in the modulation of voltage-gated potassium channels. Research into KCNIP3 has garnered attention due to its role in neuronal excitability and synaptic transmission, which are pivotal in normal brain function and implicated in various neurological disorders. Dysregulation of KCNIP3 has been associated with conditions such as epilepsy, schizophrenia, and other neurodevelopmental disorders. The protein acts as a scaffold that interacts with potassium channels like KCNQ2/3, influencing their expression, localization, and activity. Given its significance in cellular signaling and excitability, understanding the structural and functional properties of KCNIP3 is essential for elucidating its contributions to neuronal pathophysiology. Recent studies have focused on the characterization of KCNIP3 recombinant protein to facilitate investigations into its molecular interactions and functional mechanisms. By employing techniques such as overexpression and purification of the recombinant form of KCNIP3, researchers aim to explore its biophysical properties and interaction with potassium channels in detail. This research not only aims to deepen the understanding of KCNIP3's biological functions but also seeks potential therapeutic targets for drug development in treating associated neurological disorders. As such, KCNIP3 represents a promising focus for ongoing research in neurobiology and pharmacology.
