Analytical Data
-
Gene name
KCTD8
- Application
-
Alternative Names
KCTD8; BTB/POZ domain-containing protein KCTD8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZWB6
-
Expression Region
1-473aa
-
AA Sequence
MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL
-
Molecular Weight
52.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCTD8 (Potassium Channel Tetramerization Domain Containing 8) is a member of the KCTD protein family, which plays significant roles in various cellular processes, including signal transduction, ion channel regulation, and neuronal activity. Recent studies have highlighted KCTD8's involvement in critical biological functions, such as the modulation of potassium channels and the regulation of neurotransmitter release, which could have implications in the context of neurological disorders. The expression of KCTD8 has been linked to diseases like autism spectrum disorders and schizophrenia, making it a potential biomarker or therapeutic target. Understanding the structure and function of KCTD8 through recombinant protein studies is crucial for elucidating its mechanisms of action in neural pathways. By producing and characterizing KCTD8 recombinant proteins, researchers aim to investigate its interactions with other proteins, its effects on cell signaling, and its role in potassium channel activity. This research could provide insights into the molecular basis underlying various psychiatric conditions and pave the way for targeted therapies. Furthermore, KCTD8's unique structural features may facilitate the development of novel pharmacological agents aiming to modulate its activity in disease contexts, thus emphasizing the need for comprehensive studies in this area.
