Analytical Data
-
Gene name
TNFSF8
- Application
-
Alternative Names
TNFSF8；CD30L；CD30LG；Tumor necrosis factor ligand superfamily member 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32971
-
Expression Region
63-234aa
-
AA Sequence
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
-
Molecular Weight
45.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF8, also known as 4-1BB ligand (4-1BBL), is a member of the tumor necrosis factor (TNF) superfamily that plays a crucial role in immune modulation and T cell activation. Its primary function is to enhance T cell proliferation, survival, and cytokine production, making it a key player in adaptive immunity. The expression of TNFSF8 is upregulated in various immune cells, including dendritic cells and activated T cells, and it engages with the 4-1BB receptor (CD137) on T cells to promote immune responses against tumors and infections. Given its significant role in mediating immune responses, TNFSF8 has emerged as a potential target for immunotherapy in cancer treatment, where enhancing T cell activity can lead to improved anti-tumor responses. Research has focused on the production of recombinant TNFSF8 protein to explore its therapeutic potential, investigate its mechanisms of action, and evaluate its effectiveness in combination therapies. Additionally, understanding its interactions and signaling pathways could provide insights into developing novel strategies for modulating immune responses in various diseases, including autoimmune disorders and chronic infections. As the field of immunotherapy continues to evolve, the study of TNFSF8 and its re-engineered forms holds promise for advancing treatment options and improving patient outcomes in cancer and beyond.
