Cat: PA2000-4495

Recombinant Human TNFSF8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFSF8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFSF8;CD30L;CD30LG;Tumor necrosis factor ligand superfamily member 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P32971

  • Expression Region

    63-234aa

  • AA Sequence

    QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

  • Molecular Weight

    45.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFSF8, also known as 4-1BB ligand (4-1BBL), is a member of the tumor necrosis factor (TNF) superfamily that plays a crucial role in immune modulation and T cell activation. Its primary function is to enhance T cell proliferation, survival, and cytokine production, making it a key player in adaptive immunity. The expression of TNFSF8 is upregulated in various immune cells, including dendritic cells and activated T cells, and it engages with the 4-1BB receptor (CD137) on T cells to promote immune responses against tumors and infections. Given its significant role in mediating immune responses, TNFSF8 has emerged as a potential target for immunotherapy in cancer treatment, where enhancing T cell activity can lead to improved anti-tumor responses. Research has focused on the production of recombinant TNFSF8 protein to explore its therapeutic potential, investigate its mechanisms of action, and evaluate its effectiveness in combination therapies. Additionally, understanding its interactions and signaling pathways could provide insights into developing novel strategies for modulating immune responses in various diseases, including autoimmune disorders and chronic infections. As the field of immunotherapy continues to evolve, the study of TNFSF8 and its re-engineered forms holds promise for advancing treatment options and improving patient outcomes in cancer and beyond.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US