Analytical Data
-
Gene name
KCTD6
- Application
-
Alternative Names
BTB/POZ domain-containing protein KCTD6; KCASH3; kctd6; KCTD6_HUMAN; MGC27385; potassium channel tetramerization domain containing 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NC69
-
Expression Region
1-237aa
-
AA Sequence
MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCTD6, a member of the BTB-Kelch protein family, plays a crucial role in various cellular processes, including cell signaling, differentiation, and apoptosis. Its involvement in the regulation of key signaling pathways, particularly those related to the tumor suppressor protein p53 and the E3 ubiquitin ligase complex, has attracted significant research interest. Recent studies have indicated that KCTD6 may have implications in cancer biology, as its expression levels are often altered in various tumors. Moreover, KCTD6 has been implicated in neurodevelopmental disorders, linking its function to neurogenesis and synaptic plasticity. The study of KCTD6, particularly through the generation of recombinant proteins, has been essential for understanding its structure-function relationships, post-translational modifications, and interactions with other proteins. This research could potentially unveil novel therapeutic targets for diseases related to dysregulated KCTD6 pathways. As such, generating and characterizing KCTD6 recombinant proteins allows for the investigation of its molecular mechanisms and interaction networks, laying the groundwork for future studies aimed at elucidating its biological roles and potential clinical applications.











