Analytical Data
-
Gene name
CD40
- Application
-
Alternative Names
CD40；TNFRSF5；Tumor necrosis factor receptor superfamily member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25942
-
Expression Region
21-193aa
-
AA Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETK DLVVQQAGTNKTDVVCGPQDRLR
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD40 is a co-stimulatory molecule that plays a crucial role in the regulation of immune responses, particularly in the interactions between antigen-presenting cells (APCs) and T cells. The CD40-CD40L (CD154) interaction is vital for the activation of B cells, enhancing antibody production, and facilitating the development of germinal centers, which are essential for generating high-affinity antibodies. Dysregulation of CD40 signaling has been implicated in various autoimmune diseases, cancers, and infections, making it a significant target for therapeutic interventions. The recombinant protein form of CD40 can be used as a tool to study its functional properties, stability, and potential applications in vaccine development and immunotherapy. By expressing CD40 in a recombinant system, researchers can investigate its role in T cell activation, the modulation of innate immune responses, and the potential for enhancing the efficacy of cancer vaccines. Furthermore, understanding the molecular mechanisms of CD40 signaling can lead to the development of novel therapeutic strategies aimed at modulating immune responses in various disease contexts. The exploration of CD40's role through its recombinant form yields valuable insights that could pave the way for advancements in immunotherapeutic techniques, aiming to harness or regulate the immune system for improved outcomes in disease treatment and prevention.
