Analytical Data
-
Gene name
KCTD14
- Application
-
Alternative Names
KCTD14; BTB/POZ domain-containing protein KCTD14
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ13
-
Expression Region
1-225aa
-
AA Sequence
MSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDNSDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW
-
Molecular Weight
52.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCTD14, or potassium channel tetramerization domain-containing protein 14, is a member of the KCTD protein family, which is known for its roles in various neuronal and non-neuronal processes. Recent research has identified KCTD14 as a significant player in cellular signaling pathways and has implicated it in the regulation of ion channels, particularly in relation to potassium channel activity. Its involvement in the modulation of synaptic transmission and neural development has garnered attention, especially in the context of neurodevelopmental disorders. Moreover, KCTD14 has been linked to the regulation of apoptosis and cell proliferation, further underscoring its potential role in cancer biology. The recombinant expression and purification of KCTD14 proteins facilitate in-depth biochemical and biophysical studies, enabling researchers to elucidate its functional interactions and structural characteristics. Understanding the molecular mechanisms underlying KCTD14's actions could provide insights into potential therapeutic targets for neurological diseases and cancers, making it a focal point of ongoing scientific inquiry. As such, the study of KCTD14 not only enhances our comprehension of fundamental biological processes but also opens avenues for innovative treatment strategies.
