Analytical Data
-
Gene name
TNFRSF18
- Application
-
Alternative Names
TNFRSF18；AITR；GITR；Tumor necrosis factor receptor superfamily member 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5U5
-
Expression Region
26-162aa
-
AA Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP
-
Molecular Weight
40.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF18, also known as GITR (Glucocorticoid-Induced TNFR-Related protein), is a member of the tumor necrosis factor receptor superfamily and plays a significant role in regulating immune responses. It is primarily expressed on T cells, natural killer cells, and a subset of dendritic cells, influencing their proliferation, activation, and survival. Research has shown that GITR acts as a costimulatory molecule, enhancing T cell activity and promoting anti-tumor immunity, making it a potential target for cancer immunotherapy. Studies have highlighted the therapeutic potential of GITR agonists in amplifying immune responses against tumors, thereby improving patient outcomes in various malignancies. Furthermore, the modulation of GITR signaling pathways could also provide insights into controlling autoimmune diseases, as inappropriate activation might lead to detrimental effects. Recombinant GITR proteins have been developed for both research purposes and clinical applications, facilitating the exploration of GITR's mechanisms in immune regulation and its potential as a biomarker for immunotherapy efficacy. Understanding the structure-function relationship of recombinant TNFRSF18 proteins can provide deeper insights into its role in immune modulation, paving the way for innovative therapeutic strategies targeting GITR in cancer and autoimmune diseases.
