Cat: PA1000-1684

Recombinant Human ISG15 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ISG15

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ISG15;G1P2;UCRP;Ubiquitin-like Protein ISG15

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05161

  • Expression Region

    2-157aa

  • AA Sequence

    GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSG VALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLT QTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMN LRLRGG

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ISG15 (Interferon Stimulated Gene 15) is a ubiquitin-like protein that plays a crucial role in the immune response, particularly during viral infections. It is an interferon-inducible protein, meaning its expression is significantly upregulated in response to interferon signaling, a key mechanism of the innate immune system. The research on ISG15 focuses on its role in the post-translational modification of target proteins through a process known as ISGylation, which is similar to ubiquitination but involves the conjugation of ISG15 instead. This modification has been shown to influence various cellular processes, including antiviral defense, cell signaling, and protein stability. Moreover, ISG15 is secreted by infected cells and can initiate immune responses in neighboring cells, contributing to its significance in host defense. Studies have revealed that ISG15 can modulate the activity of numerous proteins, including those involved in immune signaling pathways, suggesting its potential utility in therapeutic interventions against infections and cancer. The understanding of ISG15's mechanisms and functions may pave the way for novel strategies in antiviral therapies, enhancing our ability to manipulate the immune system for better disease management. Consequently, the recombinant production of ISG15 protein has become a focus of research, enabling the study of its structure and interactions, and potentially leading to the development of ISG15-based therapies in immunology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US