Analytical Data
-
Gene name
BSG
- Application
-
Alternative Names
BSG；Basigin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35613
-
Expression Region
138-323aa
-
AA Sequence
EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
-
Molecular Weight
49.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of BSG (Basigin, or CD147) recombinant proteins has gained significant attention in recent years due to its crucial role in various biological processes and disease pathologies. BSG is a transmembrane glycoprotein belonging to the immunoglobulin superfamily, known for its involvement in cell adhesion, intercellular signaling, and interactions with various ligands, such as cyclophilins and MCT (monocarboxylate transporters). Research has shown that BSG is upregulated in several cancers, including breast, lung, and colorectal cancers, where it contributes to tumor progression, metastasis, and immune evasion. Additionally, BSG plays a vital role in the development of the central nervous system and is implicated in inflammatory responses and autoimmune diseases. The generation of recombinant BSG proteins has allowed scientists to investigate its functional properties and interactions at a molecular level. These studies facilitate the understanding of BSG's role in physiological and pathological conditions, potentially leading to targeted therapeutic strategies. Furthermore, recombinant BSG proteins serve as valuable tools in the development of diagnostics and vaccines, enhancing our knowledge of immune responses and pathogen interactions. Overall, the exploration of BSG recombinant proteins represents a promising avenue for advancing our understanding of fundamental biological processes and developing novel therapeutic interventions.
