Cat: PA1000-1681

Recombinant Human IRF5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IRF5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IRF5;Interferon regulatory factor 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13568

  • Expression Region

    1-498aa

  • AA Sequence

    MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHA TRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDF RLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL APPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDL EIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFG EEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IRF5 (Interferon Regulatory Factor 5) is a critical transcription factor that plays a significant role in the immune response, particularly in regulating the expression of pro-inflammatory cytokines and type I interferons. Its importance has been underscored in various autoimmune diseases and inflammatory conditions, such as systemic lupus erythematosus and rheumatoid arthritis, where dysregulation of IRF5 activity is observed. Research on IRF5 recombination proteins has gained traction due to their potential therapeutic applications; these proteins can serve as clinical biomarkers or targets for drug development. The recombinant forms of IRF5 are utilized to elucidate its functional mechanisms, understand its interactions with other immune-related proteins, and explore its regulatory pathways in cellular responses. By studying these proteins, scientists aim to determine how IRF5 contributes to the pathogenesis of immune disorders, potentially leading to the identification of novel intervention strategies. The advancement of techniques in protein engineering and expression systems allows for the generation of high-purity IRF5 recombinant proteins, enabling detailed biochemical assays and structural studies. Such research is crucial for developing specific inhibitors or enhancers of IRF5 function, which could offer new avenues for treating autoimmune diseases and enhancing immune responses against infections or tumors. Overall, the study of IRF5 recombinant proteins is an essential area of investigation that may lead to significant breakthroughs in our understanding and management of immune-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US