Analytical Data
-
Gene name
RGS17
- Application
-
Alternative Names
RGS17；RGSZ2；Regulator of G-Protein signaling 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGC6
-
Expression Region
1-210aa
-
AA Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
-
Molecular Weight
51.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGS17 (Regulator of G-protein signaling 17) is a member of the RGS protein family, which plays a critical role in modulating G-protein coupled receptor (GPCR) signaling pathways. Research on RGS17 has gained attention due to its involvement in various physiological and pathological processes, particularly in cancer. Elevated levels of RGS17 have been linked to poor prognosis in several cancer types, making it a potential biomarker for tumor progression and a target for therapeutic intervention. RGS17 functions by accelerating the GTPase activity of G-proteins, thereby promoting the inactive state of GPCRs and negatively regulating signal transduction. Understanding the structure and function of RGS17, including its interactions with other proteins and signaling pathways, can provide insights into its role in disease mechanisms. Moreover, recombinant RGS17 proteins have been developed for biochemical studies, enabling detailed investigations into its regulatory functions and the potential development of RGS17-based drugs. Overall, the study of RGS17 is essential for elucidating its implications in cancer biology and the broader field of GPCR signaling modulation.
