Analytical Data
-
Gene name
CD274
- Application
-
Alternative Names
ULBP1；N2DL1；RAET1I；UL16-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZQ7
-
Expression Region
19-238aa
-
AA Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
-
Molecular Weight
52.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD274, commonly known as PD-L1, is a critical immune checkpoint protein that plays a significant role in regulating T-cell activity and immune responses. It is primarily expressed on the surface of cancer cells and various immune cells, acting as a mechanism for tumors to evade the immune system. The interaction between PD-L1 and its receptor PD-1, expressed on T-cells, leads to the inhibition of T-cell proliferation and cytokine production, ultimately contributing to immune evasion in the tumor microenvironment. Given its role in cancer immunology, CD274 has emerged as a prominent target for immunotherapy, leading to the development of various PD-1/PD-L1 inhibitors that have shown promising results in treating several malignancies, including melanoma, lung cancer, and bladder cancer. Research into recombinant CD274 protein has enhanced our understanding of its structure, function, and the mechanisms underlying its role in immune regulation. By producing recombinant CD274, scientists aim to facilitate the development of diagnostic tools, therapeutic agents, and biomarker discovery, thereby advancing personalized medicine approaches in oncology. Overall, the study of CD274 recombinant proteins has significant implications for cancer treatment and the enhancement of immune responses against tumors, paving the way for novel immunotherapeutic strategies.
