Analytical Data
-
Gene name
KCNMB2
- Application
-
Alternative Names
2700049B16Rik; 3110031N04Rik; BK channel subunit beta 2; BK channel subunit beta-2; BKbeta2; Calcium activated potassium channel subfamily M subunit beta 2; Calcium activated potassium channel subunit beta 2; Calcium-activated potassium channel; Calcium-activated potassium channel subunit beta-2; Charybdotoxin receptor subunit beta 2; Charybdotoxin receptor subunit beta-2; Hbeta2; Hbeta3; K(VCA)beta-2; K(VCA)beta2; KCMB2_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y691
-
Expression Region
1-235aa
-
AA Sequence
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
-
Molecular Weight
51.59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNMB2, a gene encoding the β2 subunit of large-conductance calcium-activated potassium (BK) channels, plays a critical role in regulating cellular excitability and maintaining physiological balance in various tissues, including the cardiovascular and nervous systems. Understanding KCNMB2 and its associated BK channels is essential for elucidating the mechanisms underlying numerous physiological processes and pathophysiological conditions, such as hypertension, neurodegeneration, and myocardial ischemia. Recent studies have highlighted the significance of KCNMB2 in modulating the channel activity by influencing voltage sensitivity and calcium dependence. The reconstitution of KCNMB2 protein is pivotal for exploring its functional properties and interactions with other channel subunits, making it a valuable tool in pharmacological screening and the development of therapeutics targeting BK channels. Additionally, advancements in recombinant protein expression techniques have enabled researchers to produce KCNMB2 in different cellular systems, facilitating detailed biophysical and biochemical characterization. Investigating the structure-function relationship of KCNMB2 not only enhances our understanding of BK channel dynamics but may also pave the way for novel treatment strategies for diseases associated with dysregulated potassium channel activity.
