Analytical Data
-
Gene name
KCNJ12
- Application
-
Alternative Names
KCNJ12; IRK2; KCNJN1; ATP-sensitive inward rectifier potassium channel 12; Inward rectifier K(+ channel Kir2.2; IRK-2; Inward rectifier K(+ channel Kir2.2v; Potassium channel. inwardly rectifying subfamily J member 12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14500
-
Expression Region
1-433aa
-
AA Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGRTPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
-
Molecular Weight
73.37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNJ12, also known as the Kir2.1 potassium channel, is a member of the inwardly rectifying potassium channel family, which plays a crucial role in maintaining the resting membrane potential and regulating excitability in various cell types, including neurons and cardiomyocytes. Mutations in the KCNJ12 gene have been associated with arrhythmias and other cardiac disorders, highlighting its significant role in physiological and pathological processes. The recombinant expression of KCNJ12 protein is essential for elucidating its functional properties and understanding its role in ion transport and electrical signaling. Researchers utilize various expression systems, such as mammalian cells or yeast, to produce functional KCNJ12 channels for biophysical and pharmacological studies. The characterization of KCNJ12 through electrophysiological techniques helps to reveal its gating mechanisms, ion selectivity, and response to pharmacological agents. Additionally, the study of KCNJ12 is vital for developing targeted therapies for conditions related to potassium channel dysfunction. Understanding the structure-function relationship of KCNJ12 can provide insights into the development of drugs aimed at modulating its activity, thereby offering potential therapeutic strategies for managing cardiac and neurological disorders linked to this channel. Given the increasing recognition of the importance of potassium channels in health and disease, research on KCNJ12 continues to be a significant area of focus in molecular physiology and pharmacology.
