Analytical Data
-
Gene name
INHBC
- Application
-
Alternative Names
INHBC;Inhibin beta C chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55103
-
Expression Region
237-352aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGIDCQGGSRMCCRQEFFVDFREIGWHDWI IQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGS CCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INHBC (Inhibin Beta C) is a member of the inhibin/activin family, which plays a critical role in the regulation of various biological processes, including reproductive functions and overall hormonal balance. Research has highlighted its significance in modulating the activity of gonadotropin-releasing hormone and in influencing follicle development in ovarian tissues. Recent studies have indicated that INHBC may also be involved in other physiological processes, such as inflammation and cancer progression. The recombinant production of INHBC protein has garnered considerable interest for potential therapeutic applications and as a tool for biological research. By utilizing advanced techniques in molecular biology, scientists are able to produce high-purity recombinant INHBC, facilitating its use in functional assays to explore its role in cellular signaling pathways and to assess its potential as a biomarker or therapeutic target. Understanding the structural and functional characteristics of INHBC at the molecular level can pave the way for new insights into its role in health and disease, making it a prominent focus in both endocrinology and oncology research.
