Analytical Data
-
Gene name
KCNIP4
- Application
-
Alternative Names
A type potassium channel modulatory protein 4; A-type potassium channel modulatory protein 4; CALP; Calsenilin like protein; Calsenilin-like protein; HGNC:30083; KCHIP 4; KChIP4; KCIP4_HUMAN; KCNIP 4; Kcnip4; Kv channel interacting protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PIL6
-
Expression Region
1-250aa
-
AA Sequence
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
-
Molecular Weight
53.24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNIP4, also known as K+ channel interacting protein 4, is a member of the KCNIP family, which plays a critical role in modulating the activity of voltage-gated potassium channels. It is involved in various physiological processes, including neuronal excitability and cardiac function. Understanding the structure and function of KCNIP4 is essential for unraveling its role in cellular signaling and potential pathophysiological conditions, such as epilepsy, arrhythmias, and other neurological disorders. The production of recombinant KCNIP4 protein allows researchers to investigate its interactions with ion channels and other cellular proteins, facilitating insights into its molecular mechanisms. Recent advancements in recombinant protein technology enable the generation of high-quality KCNIP4, which can be used in functional assays to explore its effects on potassium channel dynamics. This research has the potential to uncover new therapeutic targets for conditions linked to ion channel dysregulation, emphasizing the significance of KCNIP4 in both basic and translational neuroscience. Additionally, understanding KCNIP4 interactions may reveal broader insights into the modulation of ion channels, which are critical for various cellular activities and have implications in drug development strategies aimed at treating channelopathies.
