Analytical Data
-
Gene name
KCNG3
- Application
-
Alternative Names
KCNG3; Potassium voltage-gated channel subfamily G member 3; Voltage-gated potassium channel subunit Kv10.1; Voltage-gated potassium channel subunit Kv6.3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAE7
-
Expression Region
1-436aa
-
AA Sequence
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVIKLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSIPAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELKFRSARYSRSLSTEFLN
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNG3, also known as K_v6.3, is a member of the potassium channel family that plays a significant role in various physiological processes, including neuronal excitability and the regulation of dopamine release. Its expression is notably observed in the brain, particularly in the cortical and subcortical regions, where it contributes to the modulation of neuronal firing patterns. Research has indicated that KCNG3 is implicated in several neurological disorders, such as schizophrenia and epilepsy, highlighting the need for a deeper understanding of its functions and regulation. The study of KCNG3 recombinant proteins has gained attention as a valuable approach to elucidate the channel's biophysical properties and pharmacological characteristics. By producing KCNG3 in a recombinant system, researchers can investigate the channel's gating mechanisms, ion selectivity, and interaction with various pharmacological agents. This research not only enhances our knowledge of KCNG3's role in cellular physiology but also has potential therapeutic implications, as modulating its activity might offer new strategies for treating related neurological conditions. Overall, the exploration of KCNG3 recombinant protein serves as a critical avenue for advancing our understanding of potassium channels in health and disease.
