Analytical Data
-
Gene name
KCNG1
- Application
-
Alternative Names
KCNG1; Potassium voltage-gated channel subfamily G member 1; Voltage-gated potassium channel subunit Kv6.1; kH2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIX4
-
Expression Region
1-275aa
-
AA Sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPEDRRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMVEREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVTAVNLSVSTLPSLREEEEQVRAHAPRGNAPPRGKGL
-
Molecular Weight
55.99 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNG1, a member of the potassium channel gene family, encodes the voltage-gated potassium ion channel subunit known for its role in controlling neuronal excitability and modulating cellular membrane potential. Research into KCNG1 is particularly significant due to its implications in various neurological disorders, as mutations in this gene have been linked to conditions such as epilepsy and intellectual disabilities. Additionally, KCNG1's participation in cardiac function regulation highlights its importance in understanding arrhythmias and other heart-related issues. Recent advances in recombinant protein technology have enabled scientists to express and purify KCNG1 in heterologous systems, facilitating in-depth functional studies of its biophysical properties and pharmacological profiles. Understanding the structure-function relationship of KCNG1 through recombinant approaches offers valuable insights into its role in health and disease, paving the way for potential therapeutic interventions targeting potassium channel dysfunction. As research progresses, KCNG1 continues to emerge as a critical player in both basic science and clinical perspectives, reinforcing the need for ongoing exploration into its mechanisms of action and therapeutic potential.
