Cat: PA1000-1626

Recombinant Human IL23R Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL23R

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL23R;Interleukin-23 receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5VWK5

  • Expression Region

    24-353aa

  • AA Sequence

    GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKE RFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGY PPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQY LTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAA VISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTN FTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVT SKAFQHDTWNSGLTVASISTGHLTSDNRGD

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-23 receptor (IL23R) is a crucial component of the immune response, particularly in the context of inflammatory and autoimmune diseases. Its role is primarily associated with the differentiation and proliferation of T-helper 17 (Th17) cells, which are instrumental in mediating inflammation. Research has identified genetic variants in the IL23R gene that are linked to various conditions such as Crohn's disease, psoriasis, and ankylosing spondylitis. Given its significant involvement in these pathologies, IL23R has emerged as a promising therapeutic target. The development of recombinant IL23R proteins is essential for further elucidating its biological functions and for developing targeted therapies. These recombinant proteins facilitate the study of IL23R signaling pathways, interaction with ligands, and downstream immune responses, thereby offering insights into its role in disease. Understanding IL23R at a molecular level can enhance the design of specific inhibitors or biologics, potentially leading to novel treatment strategies that could ameliorate the symptoms and progression of IL23R-associated diseases. Such advancements highlight the importance of thorough research into recombinant IL23R proteins as a foundational step toward innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US