Analytical Data
-
Gene name
CCL3
- Application
-
Alternative Names
CCL3；G0S19-1；MIP1A；SCYA3；C-C motif chemokine 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10147
-
Expression Region
24-92aa
-
AA Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
-
Molecular Weight
14.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL3, also known as macrophage inflammatory protein-1 alpha (MIP-1α), is a chemokine that plays a critical role in the immune response by recruiting immune cells to sites of inflammation. It is primarily produced by macrophages, T cells, and other cells in response to various stimuli, including infections and inflammatory signals. Research on CCL3 has gained momentum due to its involvement in various pathological conditions, such as autoimmune diseases, cancer, and viral infections. The ability of CCL3 to modulate immune cell migration and activation makes it a significant target for therapeutic interventions. Recombinant CCL3 proteins have been generated for both research and potential therapeutic applications. These proteins are utilized to study the underlying mechanisms of immune responses, the development of inflammatory diseases, and the effects of CCL3 on different cell types. Additionally, understanding the structure-function relationships of CCL3 can aid in the design of novel therapeutic agents or modifications that enhance its efficacy in treating diseases characterized by dysregulated immune responses. The exploration of CCL3’s role in diverse biological processes continues to provide insights into its potential as a biomarker or therapeutic target, emphasizing its importance in the field of immunology and related research areas.
