Cat: PA1000-1613

Recombinant Human IL18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL18;IGIF;IL1F4;Interleukin-18

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14116

  • Expression Region

    37-193aa

  • AA Sequence

    MYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFII SMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDI IFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSI MFTVQNED

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-18 (IL-18) is a pro-inflammatory cytokine that plays a crucial role in the immune response, particularly in promoting the production of interferon-gamma (IFN-γ) from T and natural killer (NK) cells. Initially discovered for its ability to induce IFN-γ production, IL-18 is produced as a precursor and requires cleavage by caspase-1 for its activation. The cytokine is involved in various physiological processes, including the regulation of Th1 responses, enhancement of innate immunity, and modulation of inflammatory diseases. Due to its significant role in immune regulation, IL-18 has been studied in the context of several conditions, including infectious diseases, autoimmune disorders, and cancer. The research on recombinant IL-18 protein has gained traction as scientists seek to examine its therapeutic potential and underlying mechanisms of action. Recombinant forms of IL-18 are essential for in vitro studies, allowing researchers to explore its effects on immune cell behavior, cytokine production, and potential synergies with other immunotherapeutics. Furthermore, the development of IL-18 as a candidate for cancer immunotherapy is particularly promising, given its ability to enhance anti-tumor immune responses. However, the dual role of IL-18 in promoting both protective and pathological immune responses underscores the complexity of its application in clinical settings. Ongoing studies aim to elucidate the precise mechanisms by which IL-18 influences various immune pathways, as well as optimizing its therapeutic applications while minimizing potential adverse effects. Overall, the continued exploration of recombinant IL-18 protein is vital for advancing our understanding of immune regulation and developing novel therapeutic strategies for immune-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US