Cat: PA2000-4426

Recombinant Human IL5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL5;Interleukin-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05113

  • Expression Region

    20-134aa

  • AA Sequence

    IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQ GIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYL QEFLGVMNTEWIIES

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-5 (IL-5) is a pivotal cytokine primarily involved in the regulation of eosinophil survival, proliferation, and activation, making it a key player in allergic responses and asthma pathophysiology. Over the past few decades, research has focused on understanding the role of IL-5 in various diseases, particularly its contribution to eosinophilic disorders, such as asthma and eosinophilic esophagitis. The interest in IL-5 has been fueled by the identification of monoclonal antibodies that specifically target IL-5 or its receptor, demonstrating effectiveness in reducing eosinophil levels and improving clinical outcomes in asthma patients. Consequently, recombinant IL-5 protein has emerged as a crucial tool for elucidating the molecular mechanisms underlying its functions, facilitating the development of targeted therapeutics. Studies involving recombinant IL-5 have revealed its interaction with specific receptors on eosinophils, promoting cell signaling pathways essential for their activation and survival. This knowledge has paved the way for novel treatment strategies, thereby directing research efforts toward optimizing these therapies while also exploring the potential of IL-5 modulation in other inflammatory conditions. As the landscape of immunology continues to evolve, the understanding of IL-5 and its therapeutic implications remains vital for addressing eosinophil-mediated diseases and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US