Analytical Data
-
Gene name
ATP4b
- Application
-
Alternative Names
ATP4b;Potassium-transporting ATPase subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51164
-
Expression Region
58-291aa
-
AA Sequence
CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
-
Molecular Weight
26.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP4b, a critical enzyme belonging to the ATPase gene family, plays a significant role in ion transport and cellular homeostasis, particularly in gastric epithelial cells. Its primary function involves the regulation of intracellular pH and the secretion of gastric acid, making it pivotal for digestive processes and overall gut health. Aberrant expression or dysfunction of ATP4b has been implicated in various gastrointestinal disorders, including gastroesophageal reflux disease and peptic ulcers. Recent research interest has surged around ATP4b due to advancements in recombinant protein technology, allowing for the production of highly purified ATP4b proteins for detailed structural and functional studies. Such studies aim to elucidate the enzyme's mechanism of action, assess its role in pathophysiological conditions, and explore its potential as a therapeutic target. Moreover, understanding the regulation of ATP4b activity at the molecular level may provide insights into novel treatment strategies for gastric diseases. By investigating the recombinant forms of ATP4b, researchers are laying the groundwork for future pharmacological interventions, potentially leading to innovative therapies that could improve patient outcomes in digestive health.











