Analytical Data
-
Gene name
IL17B
- Application
-
Alternative Names
IL17B;IL20;NIRF;ZCYTO7;Interleukin-17B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHF5
-
Expression Region
21-180aa
-
AA Sequence
M+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEE MVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPE ARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAV METIAVGCTCIF
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-17B (IL-17B) is a member of the IL-17 cytokine family, known for its roles in immune response and inflammation. Initially discovered for its similar structure to other IL-17 family members, IL-17B has gained attention due to its involvement in various physiological and pathological processes. Research indicates that IL-17B is produced by different cell types, including T cells and epithelial cells, and plays a significant role in mediating inflammation and immune responses in numerous diseases, including autoimmune disorders, cancer, and infections. Recent studies have shown that IL-17B can influence the behavior of various immune cell types, enhancing the understanding of its function in tumor microenvironments and chronic inflammatory conditions. Importantly, IL-17B's receptor, IL-17RB, has been implicated in signaling pathways that promote cell survival, proliferation, and the release of pro-inflammatory cytokines. This has established IL-17B as a potential therapeutic target for modulating immune responses. As research progresses, the development of recombinant IL-17B proteins for experimental use may provide valuable insights into its biological functions and therapeutic potential, paving the way for novel treatment strategies for diseases driven by dysregulated immune responses. Understanding the precise mechanisms of IL-17B action could contribute significantly to the field of immunology and open avenues for innovative therapeutic approaches aimed at manipulating immune responses for better clinical outcomes.
