Analytical Data
-
Gene name
IL17A
- Application
-
Alternative Names
IL17A;CTLA8;IL17;Interleukin-17A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16552
-
Expression Region
24 -155aa
-
AA Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR REPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-17A, a pro-inflammatory cytokine produced primarily by T helper 17 (Th17) cells, plays a crucial role in mediating immune responses, particularly in the context of autoimmune diseases and chronic inflammatory conditions. Research into IL-17A has gained significant attention due to its involvement in various pathologies such as rheumatoid arthritis, psoriasis, and multiple sclerosis. The dysregulation of IL-17A production is linked to the exacerbation of these diseases, making it a key target for therapeutic interventions. Recombinant IL-17A protein has been utilized in studies to understand its biological functions, signaling pathways, and interactions with other immune components. By producing IL-17A in a recombinant form, researchers can manipulate its levels in vivo and in vitro, allowing for the exploration of its role in immune responses and disease mechanisms. Furthermore, the development of IL-17A inhibitors, such as monoclonal antibodies targeting this cytokine, has shown promise in clinical settings, highlighting the importance of studying its recombinant form for both basic research and potential therapeutic applications. Understanding the structure, function, and regulation of IL-17A through recombinant technology not only enhances our knowledge of immune system dynamics but also paves the way for novel treatment strategies aimed at controlling IL-17A-mediated inflammation.











