Analytical Data
-
Gene name
JTV1
- Application
-
Alternative Names
Aimp2; AIMP2_HUMAN; Aminoacyl tRNA synthase complex-interacting multifunctional protein 2; Aminoacyl tRNA synthetase complex interacting multifunctional protein 2 ; ARS interacting multi functional protein 2 ; JTV 1; JTV 1 protein; JTV1; JTV1 gene
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13155
-
Expression Region
1-320aa
-
AA Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
-
Molecular Weight
39.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JTV1, a protein originally identified in plants, has garnered significant attention in the field of biotechnology and proteomics due to its role in various biological processes, including stress responses and development. The research surrounding JTV1 focuses on its potential applications in agriculture and medicine, particularly its ability to enhance stress tolerance in crops and its involvement in cellular signaling pathways. Studies have shown that JTV1 may facilitate the regulation of gene expression during environmental stress, making it a candidate for developing genetically modified plants with improved resilience. Additionally, the recombinant expression of JTV1 in microbial systems allows for detailed characterization of its functional properties, further elucidating its biological significance. This research is crucial, particularly in the context of global climate change, where crop productivity and sustainability are increasingly threatened. By advancing our understanding of JTV1 and its applications, researchers aim to leverage this protein's unique properties to contribute to food security and development of novel therapeutic approaches in human health.
