Analytical Data
-
Gene name
IL12P40
- Application
-
Alternative Names
IL12B;NKSF2;Interleukin-12 subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29460
-
Expression Region
23-328aa
-
AA Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSG KTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKE PKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYEN YTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLT FCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW ASVPCS
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-12 p40 is a subunit of the interleukin-12 (IL-12) cytokine, which plays a pivotal role in the immune response by promoting the differentiation of T cells and activating natural killer (NK) cells. Research on recombinant IL-12 p40 protein has gained significant attention due to its potential therapeutic applications in various diseases, particularly in cancer and infectious diseases. The dual action of IL-12 p40 in modulating immune responses, including enhancing Th1 cell responses and producing other pro-inflammatory cytokines, makes it a valuable target for immunotherapy. Studies have shown that the administration of recombinant IL-12 p40 can lead to tumor regression in animal models and improve immune responses against viral infections. Additionally, understanding the mechanisms underlying the activity of IL-12 p40 can aid in the development of novel treatment strategies that harness the immune system's ability to fight diseases. Furthermore, due to its involvement in autoimmune disorders, examining IL-12 p40 levels may offer insights into disease progression and patient prognosis. Overall, the exploration of recombinant IL-12 p40 protein not only underscores its importance in the field of immunology but also highlights its potential for enhancing therapeutic interventions in various clinical settings.
