Analytical Data
-
Gene name
JMJD1B
- Application
-
Alternative Names
5qNCA; C5orf7; JHDM2B; JmjC domain containing histone demethylation protein 2B; JmjC domain-containing histone demethylation protein 2B; jmjd1b; Jumonji domain containing 1B; Jumonji domain containing protein 1B; Jumonji domain-containing protein 1B; KDM3B; KDM3B_HUMAN; KIAA1082; Lysine (K) specific demethylase 3B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7LBC6
-
Expression Region
1498-1721aa
-
AA Sequence
MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
-
Molecular Weight
45.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JMJD1B (Jumonji domain containing 1B) is a member of the Jumonji C (JmjC) domain-containing proteins, which are characterized as histone demethylases that play a critical role in epigenetic regulation. This protein is primarily involved in the demethylation of histone lysine residues, particularly H3K9me2, thereby influencing gene expression and cellular differentiation. Recent studies have highlighted the significance of JMJD1B in various biological processes, including development, stem cell maintenance, and tumorigenesis. Aberrations in JMJD1B expression have been linked to several diseases, including cancer, where it can either function as a tumor suppressor or an oncogene depending on the context. As such, understanding the mechanisms of JMJD1B function and regulation is essential for elucidating its role in health and disease. Researchers have aimed to produce recombinant JMJD1B proteins to investigate its enzymatic activity, interaction with other proteins, and its overall impact on chromatin dynamics. The generation of these recombinant proteins facilitates the study of JMJD1B in vitro and in vivo, providing insights into its biological functions and potential therapeutic applications. Investigating JMJD1B not only enhances our understanding of epigenetic regulation but also has implications for the development of targeted therapies in conditions where JMJD1B is implicated.
