Analytical Data
-
Gene name
JARID2
- Application
-
Alternative Names
JARD2; JARD2_HUMAN; JARID2; JMJ; Jumonji AT rich interactive domain 2 ; Jumonji homolog; Jumonji like protein; Jumonji protein; Jumonji/ARID domain containing protein 2; Jumonji/ARID domain-containing protein 2; Protein Jumonji
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92833
-
Expression Region
1130-1229aa
-
AA Sequence
LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JARID2 (Jumonji and AT-rich interaction domain 2) is a member of the Jumonji C domain-containing protein family, which plays a crucial role in chromatin remodeling and gene regulation. It is known for its involvement in various biological processes, including stem cell differentiation, development, and oncogenesis. JARID2 functions as a core component of the PRC2 (Polycomb Repressive Complex 2), contributing to the establishment and maintenance of gene silencing through histone modifications. Recent studies have highlighted its significance in embryonic stem cell pluripotency and differentiation pathways, as well as its potential implications in cancer biology, particularly in the context of tumorigenesis and metastasis. The recombinant expression of JARID2 allows for detailed investigation into its structural and functional properties, facilitating the understanding of its regulatory mechanisms at the molecular level. This research is particularly important for elucidating the complex interactions between JARID2 and other epigenetic regulators, which could provide insights into novel therapeutic targets for cancers and other diseases associated with dysregulated gene expression. Moreover, understanding the role of JARID2 in chromatin architecture may unveil new perspectives on how epigenetic modifications influence cellular identity and function, thus offering potential avenues for regenerative medicine and cancer treatment.
