Analytical Data
-
Gene name
IFNA1
- Application
-
Alternative Names
IFNA1；IFNA13；Interferon alpha-1/13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01562
-
Expression Region
24-189aa
-
AA Sequence
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQK APAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACV MQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMR SLSLSTNLQERLRRKE
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFNA1, or Interferon Alpha 1, is a cytokine that plays a crucial role in the immune response against viral infections and in the regulation of immune cell activities. It belongs to the type I interferon family, which is known for its antiviral, antiproliferative, and immune-modulating properties. Given its significant role in antiviral defense and its potential therapeutic applications, including treatments for viral infections, cancers, and autoimmune diseases, the study of IFNA1 has garnered considerable attention. Recombinant IFNA1 proteins have been developed for research and clinical applications, enabling scientists to explore its mechanisms of action, cellular interactions, and effects on various immune cell types. The production of IFNA1 in a recombinant form allows for controlled studies on dosage, timing, and methods of administration, aiding in the development of targeted therapies. Additionally, the examination of IFNA1’s efficacy in combination with other treatments, such as vaccines or other immunotherapies, is an active area of research. Innovations in biotechnological methods for producing and purifying recombinant IFNA1, along with advances in understanding its signaling pathways, are essential for harnessing its potential in therapeutic contexts. As our knowledge of IFNA1 expands, the protein promises to play an even larger role in immunotherapy, providing new avenues for the treatment of various pathologies where immune modulation is critical.
