Cat: PA1000-1584

Recombinant Human IL-15 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-15

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL15;Interleukin-15

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P40933

  • Expression Region

    49-162aa

  • AA Sequence

    NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVI SLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINTS

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-15 (IL-15) is a pivotal cytokine involved in the regulation of immune responses, particularly in the proliferation and activation of natural killer (NK) cells and CD8+ T cells. Its unique role in enhancing immune responses has garnered significant interest in the field of immunotherapy, especially for cancer treatment and infectious diseases. Unlike other cytokines, IL-15 can be produced by various cell types and possesses a mechanism of action that allows it to be presented on the surface of cells, making it a crucial factor in maintaining memory T cells and supporting the survival of lymphocytes. Research on recombinant IL-15 protein has revealed its potential not only in boosting immune cell function but also in improving the efficacy of vaccines and therapeutic protocols. This exploration has led to advances in designing IL-15-based therapies, including its use in combination with monoclonal antibodies and other immunotherapeutic agents. Furthermore, understanding the molecular mechanisms underlying IL-15 signaling has opened new avenues for targeted therapies aimed at modulating immune responses in cancer and other diseases. Ongoing studies are focused on optimizing delivery methods, understanding dosage effects, and minimizing potential side effects, while preclinical and clinical trials are assessing the safety, tolerability, and effectiveness of recombinant IL-15 in various therapeutic contexts. The compelling properties of IL-15 make it a promising candidate for enhancing immunotherapeutic strategies, emphasizing the need for continued investigation into its therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US