Analytical Data
-
Gene name
TNFSF15
- Application
-
Alternative Names
TNFSF15；TL1；VEGI；Tumor necrosis factor ligand superfamily member 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95150
-
Expression Region
72-251aa
-
AA Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
-
Molecular Weight
25.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF15, also known as tumor necrosis factor ligand superfamily member 15, is a cytokine that plays a crucial role in immune regulation and inflammation. It is primarily expressed in various tissues, including the intestines, and is involved in the development and maintenance of the gut-associated lymphoid tissue. Research into TNFSF15 has gained significant attention due to its potential implications in various diseases, particularly inflammatory bowel disease (IBD) and cancer. Dysregulation of TNFSF15 has been linked to increased inflammatory responses and alterations in immune cell function, highlighting its dual role in promoting both immune protection and pathogenic inflammation. The recombinant form of TNFSF15 has been developed for various applications, including the study of immune responses and therapeutic interventions. By understanding its interactions with receptors and downstream signaling pathways, researchers aim to elucidate the mechanisms by which TNFSF15 modulates immune responses and contributes to disease processes. This research not only enhances our knowledge of TNFSF15's biological functions but also opens up potential avenues for developing novel therapeutic strategies targeting inflammatory and autoimmune disorders.
