Analytical Data
-
Gene name
FUT6
- Application
-
Alternative Names
FUT6；FCT3A；4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51993
-
Expression Region
1-359aa
-
AA Sequence
MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FUT6, or fucosyltransferase 6, is an important enzyme involved in the addition of fucose, a monosaccharide, to glycoproteins and glycolipids, thereby playing a critical role in cell-cell interactions, immune response, and various biological processes. This enzyme is primarily expressed in certain tissues, including the brain and immune cells, making it relevant in the context of developmental biology and immunology. Research into FUT6 has gained momentum due to its potential implications in health and disease, particularly in cancer progression and autoimmune disorders. Aberrant fucosylation patterns, influenced by FUT6 activity, have been linked to tumor metastasis and immune evasion, suggesting that targeting this enzyme could provide novel therapeutic strategies. By creating recombinant FUT6 proteins, researchers aim to study the enzyme's structure-function relationships, elucidate its biochemical pathways, and devise methods for manipulating fucosylation in therapeutic contexts. Understanding the regulation of FUT6 and its biological impact may ultimately contribute to advances in targeted therapies and biomarker development for various diseases.
