Analytical Data
-
Gene name
GRIN2A
- Application
-
Alternative Names
GRIN2A；NMDAR2A；Glutamate receptor ionotropic. NMDA 2A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12879
-
Expression Region
501-550aa
-
AA Sequence
VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRIN2A is a gene that encodes a subunit of the NMDA receptor, which plays a critical role in synaptic plasticity, learning, and memory formation in the central nervous system. Mutations and alterations in GRIN2A have been linked to various neurodevelopmental disorders, including epilepsy, intellectual disability, and autism spectrum disorders, making it a significant focus in neuroscience and genetic research. The study of GRIN2A is crucial not only for understanding the molecular mechanisms underlying these conditions but also for developing targeted therapies. Recombinant protein expression of GRIN2A can provide valuable insights into its functional properties and interactions, facilitating the investigation of its role in neuronal signaling pathways. Researchers utilize different expression systems to produce GRIN2A protein, enabling them to study its pharmacological characteristics, ligand binding, and structural dynamics. The detailed analysis of GRIN2A recombinant proteins holds promise for elucidating the pathophysiological mechanisms of related disorders and advancing therapeutic strategies aimed at modulating NMDA receptor activity. Understanding GRIN2A's structure and function can ultimately contribute to the development of innovative treatments for patients affected by GRIN2A-associated neurological disorders.
