Analytical Data
-
Gene name
IFT20
- Application
-
Alternative Names
IFT20;Intraflagellar transport Protein 20 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IY31
-
Expression Region
1-132aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAKDILGEAGLHFDELNKLRVLDPEVTQQT IELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLK SIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIF QK
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFT20 (Intraflagellar Transport 20) is a protein that plays a crucial role in the intraflagellar transport (IFT) process, which is essential for the assembly and maintenance of cilia and flagella in eukaryotic cells. Cilia and flagella are important cellular structures involved in various functions, such as motility, sensory perception, and signal transduction. Research has shown that IFT20 is involved in transporting protein complexes along the ciliary axoneme, facilitating the movement of essential components needed for ciliary growth and function. Mutations or alterations in the IFT20 gene have been linked to several ciliopathies, which are human diseases resulting from dysfunctional cilia. These conditions can lead to a range of health issues, including respiratory problems, kidney disease, and neurological disorders. As such, understanding the structure, function, and regulation of IFT20 is vital for elucidating the mechanisms underlying ciliopathies and developing targeted therapies. Recent studies have focused on the structural biology of IFT20, exploring its interactions with other IFT proteins and determining how it integrates into the IFT system. This research holds promise for advancing our knowledge of ciliary biology and developing potential clinical applications to address ciliopathy-related disorders. Insights from the study of IFT20 may also contribute to broader fields, such as regenerative medicine and developmental biology, highlighting the significance of this protein in cellular function and organismal health.











