Cat: PA1000-1572

Recombinant Human IFNL3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IFNL3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IFNL3;IL28B;IL28C;ZCYTO22;Interferon lambda-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14879

  • Expression Region

    1-490aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSEVTKNSLEKILPQLKCHFTWNLFKE DSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAALECLRQA EELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKF SNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLA IAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGE QFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYL YHQIGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLN PLNAYSDLAEFLETECYQTPFNKEVPDAEKQQSHQRYCNLQKYNGKSEDT AVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQ NGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSS SPRELLSNSEQLN

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IFNL3, a member of the interferon lambda family, plays a crucial role in the innate immune response against viral infections. It is primarily produced by epithelial cells in response to pathogen recognition and has been implicated in the regulation of immune responses, particularly against viruses such as hepatitis C and influenza. Research into IFNL3 has gained momentum due to its potential therapeutic applications in treating viral infections and its association with viral clearance outcomes in infected individuals. Variations in the IFNL3 gene have been linked to differing responses to antiviral therapies, highlighting its significance in personalized medicine. Moreover, studies have indicated that IFNL3 may influence intestinal health and gut microbiota composition, indicating a broader impact on overall immune function. Understanding the mechanisms of IFNL3 production, its signaling pathways, and its interactions with other immune components is vital for developing targeted therapies. Consequently, IFNL3 recombinant proteins are being explored in preclinical and clinical settings to assess their efficacy and safety as potential therapeutics, paving the way for novel strategies in combating viral diseases and enhancing host defense mechanisms. As ongoing research continues to unveil the complexities of IFNL3's role in immune responses, it holds promise for innovative approaches in immunotherapy and personalized treatment regimens.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US