Analytical Data
-
Gene name
ISCA1
- Application
-
Alternative Names
GK004; HESB-like domain-containing protein 2; hIscA; Iron sulfur assembly protein IscA; Iron-sulfur assembly protein IscA; Iron-sulfur cluster assembly 1 homolog; Iron-sulfur cluster assembly 1 homolog. mitochondrial; ISCA1; ISCA1_HUMAN; mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUE6
-
Expression Region
1-129aa
-
AA Sequence
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
-
Molecular Weight
39.93 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ISCA1, or Iron-Sulfur Cluster Assembly 1, is a crucial protein involved in the biogenesis of iron-sulfur (Fe-S) clusters, which are essential cofactors for various metabolic processes in both prokaryotic and eukaryotic organisms. These iron-sulfur clusters play vital roles in electron transport, enzyme catalysis, and cellular redox balance. Mutations or deficiencies in ISCA1 have been linked to severe mitochondrial dysfunction and other metabolic disorders, including neurodegenerative diseases. Recent studies have focused on the structural and functional characterization of ISCA1 recombinant proteins to better understand their role in Fe-S cluster assembly and the broader implications for cellular health. By expressing ISCA1 in heterologous systems, researchers aim to elucidate its mechanism of action, interaction with other mitochondrial proteins, and contribution to cellular iron homeostasis. Such investigations are pivotal in uncovering potential therapeutic targets for treating diseases associated with impaired Fe-S cluster assembly, thereby highlighting the significance of ISCA1 in both fundamental biology and medical research.
