Analytical Data
-
Gene name
IGF2
- Application
-
Alternative Names
IGF2；Insulin-like growth factor II
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01344
-
Expression Region
25-91aa
-
AA Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Insulin-like growth factor 2 (IGF2) is a significant peptide hormone involved in growth and development, particularly during fetal growth and postnatal development. As a member of the insulin family, IGF2 plays a crucial role in cellular processes such as proliferation, differentiation, and apoptosis. The aberrant expression of IGF2 has been linked to various diseases, including cancer, where it may promote tumor growth and metastasis. Recombinant IGF2 proteins have been developed for various research and therapeutic purposes, allowing scientists to investigate its physiological functions, signaling pathways, and potential roles in disease mechanisms. Understanding IGF2’s biological activity and its interactions with IGF receptors can lead to novel therapeutic strategies, especially in regenerative medicine and cancer treatment. The production of recombinant IGF2 in heterologous systems, such as yeast or mammalian cells, enables the generation of sufficient quantities for in vitro studies and potential clinical applications. This research area is critical not only for elucidating the fundamental biology of IGF2 but also for advancing medical therapies that target IGF2-related pathways, ultimately improving treatment outcomes for patients affected by related disorders.
