Analytical Data
-
Gene name
IFNL2
- Application
-
Alternative Names
IFNL2;IL28A;ZCYTO20;Interferon lambda-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZJ0
-
Expression Region
26-200aa
-
AA Sequence
VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRC HSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQ PLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLE ASVTFNLFRLLTRDLNCVASGDLCV
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFNL2, also known as Interferon Lambda 2, is a member of the type III interferon family, which plays a crucial role in the immune response against viral infections. Research into IFNL2 has gained momentum due to its unique mechanisms and potential therapeutic applications, particularly in chronic viral infections like hepatitis C and various types of cancer. Unlike traditional type I interferons, IFNL2 exerts its effects through a distinct receptor system, which may offer advantages in terms of safety and efficacy. Studies have shown that individuals with specific genetic variants related to the IFNL2 gene exhibit different responses to viral infections and treatments, highlighting the importance of genetic factors in therapeutic outcomes. This has led to exploration into the development of IFNL2-based therapies that could enhance antiviral responses while minimizing side effects. Furthermore, researchers are investigating the signaling pathways activated by IFNL2 and its potential role in modulating immune responses beyond viral infections. Overall, the ongoing investigation of IFNL2 is poised to unlock new insights into immune regulation and pave the way for innovative treatment strategies in infectious diseases and immune-related conditions.
