Analytical Data
-
Gene name
REG3g
- Application
-
Alternative Names
REG3g；PAP1B；Regenerating islet-derived Protein 3-gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UW15
-
Expression Region
27-175aa
-
AA Sequence
EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKL VSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTD VMNYFAWEKNPSTILNPGHCGSLSRSTGFL KWKDYNCDAKLPYVCKFKDVDHHHHHH
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
REG3g (Regenerating Islet-Derived 3 gamma) is a member of the Reg family of proteins, which are known for their role in the regeneration of pancreatic beta cells and involvement in innate immunity, particularly in the gastrointestinal tract. Emerging research has highlighted REG3g's antimicrobial properties and its potential role in maintaining intestinal homeostasis. Its expression is upregulated in response to intestinal injury and inflammation, suggesting a protective role against pathogen invasion and a regulatory function in gut microbiota. Additionally, REG3g has been implicated in various diseases, including inflammatory bowel disease (IBD) and colorectal cancer, making it a target of interest for therapeutic interventions. Studies indicate that REG3g not only possesses bactericidal activity against a range of pathogens but also plays a crucial role in modulating inflammatory responses. Understanding the mechanisms underlying REG3g's function could provide insights into its potential as a biomarker for gastrointestinal diseases and its utility in developing novel treatment strategies. Researchers are now focusing on elucidating the signaling pathways associated with REG3g and its interactions with gut microbes, aiming to harness its properties for therapeutic applications in gut health and disease management. Overall, the study of REG3g represents a promising avenue for advancing our understanding of intestinal biology and the development of innovative treatments for related disorders.
