Analytical Data
-
Gene name
HUS1
- Application
-
Alternative Names
HUS1;Checkpoint Protein HUS1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60921
-
Expression Region
1-280aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKFRAKIVDGACLNHFTRISNMIAKLAKTC TLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIY LELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVT HDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEV HIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HUS1 is a key protein involved in the DNA damage response and cell cycle regulation, playing a critical role in maintaining genomic stability. It forms part of the 9-1-1 complex, which is essential for the activation of checkpoint signaling pathways in response to DNA damage, particularly during replication stress. Research has shown that HUS1 interacts with various proteins, facilitating the recruitment of repair factors to sites of DNA lesions. The importance of HUS1 is underscored by its involvement in cancer biology, as mutations or dysregulation of this protein can lead to increased susceptibility to genomic instability, ultimately contributing to tumorigenesis. Moreover, understanding the structural and functional properties of HUS1 through recombinant protein studies can provide insights into its mechanism of action and its potential as a therapeutic target. Recent advancements in molecular biology techniques have enabled the production of recombinant HUS1, allowing researchers to dissect its interactions and functional roles in greater detail. Investigating HUS1 not only enhances our comprehension of cellular responses to DNA damage but also opens avenues for novel strategies in cancer treatment and prevention, emphasizing the need for continued research in this vital area of cellular biology.











