Cat: PA1000-1537

Recombinant Human HTATIP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HTATIP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HTATIP2;CC3;TIP30;Oxidoreductase HTATIP2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BUP3

  • Expression Region

    1-242aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAETEALSKLREDFRMQNKSVFILGASGET GRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYAS AFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLL SSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG EWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAI HDLGKAHGSLKP

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HTATIP2 (HIV-1 Tat Interactive Protein 2) is a crucial protein involved in various cellular processes, including transcriptional regulation and apoptosis. It has garnered significant attention in HIV research due to its interaction with the HIV-1 Tat protein, which is essential for viral replication and latency. Studies have shown that HTATIP2 plays a role in modulating the immune response, influencing viral persistence, and contributing to the pathogenesis of HIV infection. Moreover, its involvement in cancer biology has also been explored, as HTATIP2 has been implicated in tumorigenesis and metastasis. The recombinant expression of HTATIP2 is pivotal for elucidating its functional roles and understanding its molecular mechanisms, particularly in the context of HIV-related diseases. By producing HTATIP2 as a recombinant protein, researchers aim to investigate its activity, interaction with other proteins, and potential as a therapeutic target. This research may facilitate the development of innovative strategies for HIV treatment and enhance our understanding of its implications in cancer, thus contributing to broader biomedical knowledge.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US